28 Comments
User's avatar
Sally Gould's avatar

https://www.orbisphera.org/Pages/Articoli/7011/Ozone_Therapy_to_cure_Benign_Prostatic_Hyperplasia

OZONE THERAPY TO CURE BENIGN PROSTATIC HYPERPLASIA

Benign Prostatic Hypertrophy (BPH) is caused by enlargement of the prostate gland, which compresses the urethral canal causing partial obstruction and interfering with the ability to urinate.

It is a disease that affects most of the male population over 50.

From the surveys carried out in September 2021, it appears that more than six million Italians over the age of 50 are affected. To be precise, the following suffer from it: 50% of men between 50 and 60 years of age; 70% of men between the ages of 60 and 70; and 90% of the over 70s.

This pathology causes different types of disturbances: need to get up several times during the night to urinate; urgency to empty the bladder frequently even during the day; burning during and after urination; stream of urine that becomes weaker with a sensation of not voiding.

If neglected, BPH can cause, in the long run, anatomical obstruction of the urethra and urinary tract problems, with the need to resort to pharmacological and even surgical treatments.

The most commonly used surgical technique for the treatment of prostatic hypertrophy is transurethral endoscopic resection (TURP). According to data collected in 2003, in Italy there were 14,854 patients forced to undergo surgery.

Among the various treatments tested, ozone therapy via rectal insufflation has proved to be highly effective.

In this regard, Dr. Ermanno Lombardo, aesthetic specialist, posturologist and ozotherapist, presented, at the conclusion of the Master in Oxygen Ozone Therapy held at the Unicamillus University, a thesis entitled: “Effects of Oxygen-Ozone Therapy in Benign Prostatic Hyperplasia”.

In his thesis, Dr Lombardo illustrated the results of the clinical trial relating to 6 patients affected by Benign Prostatic Hypertrophy (BPH), treated with ozone therapy administered by transrectal infusion.

To find out more “Orbisphera” interviewed him.

Dr. Lombardo, can you explain the contents and results of your thesis “Effects of Oxygen-Ozone Therapy in Benign Prostatic Hyperplasia?

The objective of this scientific study was to evaluate the efficacy of ozone therapy practiced via the transrectal route, for the purpose of reducing the symptoms caused by BPH.

The trial was carried out on 6 male patients, aged between 57 and 84 years, suffering from BPH, who were treated with rectal insufflations of ozone, administered weekly and for a total duration of 8 weeks.

On the basis of the measurements carried out according to the international evaluation indexes (IPS score), all patients presented a marked improvement in symptoms. The most common complaints have disappeared, such as the urge to urinate at night during sleep, or the feeling of incomplete emptying. The quality of life and the state of health following the treatment were evaluated positively by all patients: all reported feeling better and living better.

We therefore have confirmation that ozone affects BPH with the reduction of edema of the prostate gland and with the elimination of inflammation that the enlargement of the prostate produces on the surrounding tissues.

Thanks to ozone, the prostate is reduced in size and no longer generates the annoying symptoms.

From a clinical point of view, the conclusions of my study overlap with those reported by various other scientific papers published in international journals.

Ozone therapy also proves to be very valid in terms of cost-benefit ratio: and this too is a reason for approval among patients.

How and when did you come across ozone therapy?

I approached ozone therapy when I was a student at the University, thanks to my first teacher, Dr. Alberto Bellelli, who taught me the use of ozone to treat pain and pathologies affecting the back But only more recently have I been able to experience the therapeutic effects of ozone in the treatment of various pathologies, thanks to Dr. Vincent Dell'Anna.

I met dr. Dell'Anna as teacher at the Masters and Tutor in clinical practice. It was he who made me discover the infinite potential of ozone treatments.

What convinced you to practice ozone therapy?

What prompted me to practice ozone therapy on a broad spectrum was precisely its versatility: it is one of the few therapeutic tools that can effectively treat different types of pathologies. Modern medicine often thinks of erasing the symptom, regardless of the cause that produced it. Ozone, on the other hand, erases pain and symptoms thanks to its causal link healing qualities. This is a revolution for modern medicine, which also involves the possibility of reducing the use of drugs.

Would you recommend its use to colleagues?

I would recommend the use of ozone therapy for a simple consideration often forgotten in medicine: "primum non nocere". In fact, ozone has no side effects.

I believe that ozone therapy should be considered in the range of tools available to every doctor, even if only in addition to standard therapies.

We have to be honest with patients: never talk about miraculous effects or sudden cures. As far as ozone is concerned, I’d change that last sentence: “ozone is only bad if you don’t use it”.

Interview by Antonio Gaspari

Director Orbisphera

www.orbisphera.org

antonio.gaspari@orbisphera.org

Expand full comment
DoorlessCarp🐭's avatar

Thank you Sally. Great to have as many treatment options available as possible.

I would like to see a paper explaining how it works (I suspect ROS mediated cell membrane damage & apotosis + inflammatory response) and for how long?

Expand full comment
Sally Gould's avatar

Hi Doorless Carp!

Anywhere near NYC? Dr .Howard Robins  is on,  I believe, West 57th St....Or Dr .Isadora Guggenheim? Dr.Terri Su, ,Dr.Rowen's wife ,is in Santa Rosa. CA. Consultations with them would be fantastic. I am not sure if Dr.Robins might have had some treatments himself!!  He seems to be exquisitely kind.

Wow!  Who brilliantly helps cancer patients like you???

All good wishes for you and more, Doorless Carp!!

P.S.  Do you ever divulge the mystery behind your name?  

Intraprostatic ozone therapy: A minimally invasive approach in benign prostatic hyperplasiaShabbir Hussain, Deepti B. Sharma, [...], and Dhananjay Sharma

Conclusion :Intraprostatic ozone injection helps to reduce the PV to some extent and can be helpful in patients who have failed TWOC even on alpha blockers and are unfit for TURP. Larger studies are required to assess the efficacy and long-term results of this technique.===========================

EXAMPLES OF OZONE THERAPY WITH DR. ROBERT ROWEN

https://www.youtube.com/watch?v=q02uSIw7J2U&list=PLwo2Q2bNqTrkCEwBfGlyDU5mEJw21T4Rzhttps:/

/www.youtube.com/watch?v=GVEcCUZSI2w&list=PLwo2Q2bNqTrkCEwBfGlyDU5mEJw21T4Rz&index=7https://

www.youtube.com/watch?v=HDuXHEIj1AY&list=PLwo2Q2bNqTrkCEwBfGlyDU5mEJw21T4Rz&index=5

Expand full comment
DoorlessCarp🐭's avatar

Hi Sally, it would be absolutely awesome to collaborate, given the opportunity I would be over there like a shot but as I'm not currently in the US it would need to be via zoom or teams.

Btw I'm not an MD, my background is plant biochem, genetics & pathology.

Quite often I didn't go looking for anti-cancer properties, it's something I came across in the literature whilst getting references for something else eg with glucosamine and inhibition of EMT via SNAIL.

My name was generated entirely randomly and was assigned to an online beta testing account which I used in a forum, so it kind of stuck...

Expand full comment
Sally Gould's avatar

https://mejbcart.substack.com/p/the-importance-of-d-uridine-the-nicotine

DOORLESS CARP, PLANT BIOCHEMIST: Have you seen wonderful mejbcart's addition to her article relative to the Monsnto plant gene enhancement patent and the patent for COVID Novavax? Thoughts? P.S. Apologies, I have no idea where you are, but I assume every one is here in the US!

https://mejbcart.substack.com/p/the-importance-of-d-uridine-the-nicotine

An old short now expanded analysis of covid19 vaccines patented by Novavax overlapping with newest Monsanto patents for plants gene ‘enhancement’. The overlap covers the widely known furin site.. At the very end of this post.

AND THANK YOU for reading, in case you got that far:) In case you read some of my previous posts with quite a bit of bioinformatics in it, here a small addition, inspired by the latest lecture of Dr. Heiko Schoening, presented in the last video posted at:https://uncutnews.ch/neue-und-interessante-videos-wenn-sex-mit-kindern-legal-werden-soll-ii-mit-dieser-aussage-haben-sie-sich-verraten-ii-alcyon-pleyaden-extra-36-ii-michael-lueders-heiko-schoening-und-mehr/The keyword with which he starts is ‘Novavax’ and the name Dr. Michael A. Mcmanus in connection with heroin and weapons industry. Here an alignment of a small segment of the injected SARS-CoV-2 Spike amino acids with piece of the recently recently by Monsanto patented “Genes and uses for plant enhancement” Patent: US 10696975-B2 30177 30-JUN-2020; (ncbi code QPU39845.1). Sbjct line is SPike2020 sequence, Query the Monsanto’s or Novavax latest patents:19.6 bits(39) 0.39 Composition-based stats. 18/55(33%) 22/55(40%) 9/55(16%)Monsanto's patent sequence in Query line, Sbjct is Spike:

Query 236 AYEPVWAIGTGKVASPQQAQEVHVAVREWLSKNVSAEVASQTRIIYGGSVNGGNS 290

+YE IG+G AS Q S + VASQ+ I Y S+ NS

Sbjct 659 SYECDIPIGAGICASYQTQTN---------SPRRARSVASQSIIAYTMSLGAENS 704

Spike's FURIN SITE!!!!!!

And now the NOVAVAX patented covid vaccine over the same Spike2020

Query 672 ASYQTQTNspqqaqsvasqsiiaYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM

ASYQTQTNSP++A+SVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM

Sbjct 672 ASYQTQTNSPRRARSVASQSIIAYTMSLGAENSVAYSNNSIAIPTNFTISVTTEILPVSM 731

=>Almost all covid injections carry the original Spike sequence with the 'prrar' segment in them from the Sbjct line(Moderna, Pfizer, etc). So doesn't it looks like the Q->R mutation, or maybe the opposite, must have some purpose in order to jump from a virus to a new synthetic plant???

Since the Spike2020 is PATENTED, and so are Monsanto’s new plants,

the question is, are people being injected with patented viral or plants parts actually??? Looking at this special Novavax covid vaccine fragment ‘spqqaqsvasqsiia‘ (QXC69972.1 NIH code), replaced in all others modmRNA based genetically modifying covid products by ‘SPRRARSVASQSII’and the similarity of that very same fragment in Monsanto patent encoding for the new GMO plant QPU39845.1 protein, here its BLAST alignment:16.9 bits(42) 2.8 9/23(39%) 12/23(52%) 0/23(0%)Query 667ASYQTQ--TNSPQQAQSVASQSIIAYTMSLGAE 689 Novavax Corona Spike

A+ T + SPQQAQ V + ++ AE

Sbjct 25 AI-GTGKVA-SPQQAQEVHVAVREWLSKNVSAE 272 MONSANTO patent

and so many other fragments like:

Query 671 AQSVASQSIIAYTMSLGAENS 691 Novavax Corona Spike QXC69972.1

+ VASQ+ I Y S+ NS

Sbjct 270 SAEVASQTRIIYGGSVNGGNS 290 MONSANTO patent QPU39845.1

which when changing BLAST algorithm can end up with

23.8 bits(48) 0.024 15/41(37%) 16/41(39%) 16/41(39%)

Query 250 SPQQAQEVHVAVREWLSKNVSAEVASQTRIIYGGSVNGGNS 290 'Vaccine'

SPQQAQ VASQ+ I Y S+ + NS

Sbjct 667 SPQQAQ----------------SVASQSIIAYTMSLGAENS 691 GMO plant

clearly implicate no randomniss in that fragment with some function... The things get stranger when checking all that with an old Hemophilus Influenza protein (NIH code at https://www.ncbi.nlm.nih.gov/protein/ABQ99175.1 ) phospho-2-dehydro-3-heoxyheptonate aldolase, a predicted choline kinase involved in LPS biosynthesis with that incredible sequence posted here already couple of times on mutiple occiasions:MQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQSINQ

IVGFVKTCYKPEEVFHFLHQNSIPFSSIGGMTNQNVLLNISGIKFVLRIPNAVNLSLINREYEAFNNAQA

YRAGLNVETPVLDAKSGVKLTRYLENSKPLSQIQLNEQSCLSQVVNNLYRLHNSEFVFRNVFSVFDEFRQ

YFSLLENKSAFYQADSKMDKLSAVFWQFEEINKEIILRPCHNDLVPENMLLQDDRLFFIDWEYSGLNDPL

FDIATIIEEAHLSKEAADFLLETYCNQTNKYHKTEFQIAHKRLKIHRFCQNVLWFLWTKVKEEHGENFGD

YALKRLDAAFKLLEELPWhen comparing that who knows how old sin-ful protein with the patented Spike from Novavax one gets again, huge amount of common smaller peptides, here some examples:21.4 bits(43) 0.16 5/7(71%) 6/7(85%) 0/7(0%)Query 178 EFVFKNI 184 QXC69972.1 Novavax patent US 10953089

EFVF+N+

Sbjct 195 EFVFRNV 201 ABQ99175.1 (amino acid)

Query 437 NYLYRL------FR 444

N LYRL FR

Sbjct 186 NNLYRLHNSEFVFR 199

Query 1155 DISGINASVVNIQKEIDRLNEVAKNLNESLIDLQELGKYE 1194

+ISGI V I N V NL SLI+ E YE

Sbjct 109 NISGIK-FVLRIP------NAV--NL--SLIN-RE---YE 133

Query 942 NAQA----LN 947

NAQA LN

Sbjct 137 NAQAYRAGLN 146

Query 327 EVF-----NATRFASV 337

EVF N F S+

Sbjct 83 EVFHFLHQNSIPFSSI 98

Query 672 QSVASQSI 679 <<<

QS+ QSI

Sbjct 34 QSI-NQSI 40 <<<<<8 of those SIN sections

Query 672 QSVASQSIIAYTMSLGAENSVAYSNNSI 699 insertion in covid SPike

QS+ QSI N SI

Sbjct 18 QSI-NQSI----------------NQSI 28

Query 636 CLIGAEHVNNSY 647

CL + VNN Y

Sbjct 180 CL--SQVVNNLY 189

Query 892 RFNGIGVTQNVL 903

RF QNVL

Sbjct 327 RF-----CQNVL 333

Query 102 QSLLIVNNATN-VV--IKVC----E-FQF 122

QS +N N +V +K C E F+F

Sbjct 62 QS---INQSINQIVGFVKTCYKPEEVFHF 87

BLAST won't align the aromatic tryptophans, so essential, so manual try:

QYIKWPWYIWLGFIAGL Spike

Q + W ++W

QNVLW--FLWTKVKEEHGEN Haem Infl.

The new covid19 seemed like the old flu in 2020… Just the Haemophilus influenzae PittGG strain is not a virus, it is a bacterium….No matter what, PLEASE warn every single fellow human about the incredible evil related to covid gene modifying injections, in case you ever heard anything about Monsanto."

Expand full comment
DoorlessCarp🐭's avatar

Indeed there are the patents and unnatural part sequences for various random organisms, including Yersinia pestis!

Are There Hidden Genes in DNA/RNA Vaccines?

https://doorlesscarp953.substack.com/p/are-there-hidden-genes-in-dnarna

Expand full comment
Sally Gould's avatar

Thank you so much for the kindness of your reply.

I am sending your link to mejbcart!

Absolutely, all good wishes to you this holiday season!!!

Expand full comment
Sally Gould's avatar

DR. PAUL COTTRELL'S ADMONITION"

"Sorry, but you are going to get post-covid cancer. Should have listened to me in 2020. BOOM!!!"

pubmed.ncbi.nlm.nih.gov Cancer as a prospective sequela of long COVID-19 - PubMed As the spread of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) continues to surge

For me, the thought that COVID proteins could potentially down-stream have an effect on tumor suppressor genes, like p53 and the BRCA genes, is horrifying. Futher, from the study:

"Hypoxia due to inflammation or virus-induced angiotensin-converting enzyme 2 depletion can induce oxidative stress  and malignant transformation."

Expand full comment
DoorlessCarp🐭's avatar

This paper was retracted for no legitimate reason, and not at the request of the authors therefore it's conclusions still stand:

SARS–CoV–2 Spike Impairs DNA Damage Repair and Inhibits V(D)J Recombination In Vitro

https://www.mdpi.com/1999-4915/13/10/2056

Arkmedic reviews it here:

Welcome to Gilead

A scientific scandal with huge implications for women's health is brewing and you weren't going to hear about it - until now.

July 30, 2022 by Dr Ah Kahn Syed

https://arkmedic.substack.com/p/welcome-to-gilead?r=h55li

Horrifying is the word. Most of us should be on an anticancer, cardioprotective diet right now.

Bioavailability of some of our therapeutics is an issue but a good biome is supportive and synergies with piperine or silymarin are indicated.

They also often work better as extracts with hundreds of compounds left intact rather than being administered as single compounds for the same reason

Work on nanotech & delivery systems is also progressing well in this field.

Expand full comment
Sally Gould's avatar

https://pubmed.ncbi.nlm.nih.gov/33914346/ Bioessays. 2021 Jun;43(6):e2000331. doi: 10.1002/bies.202000331. 

Epub 2021 Apr 29.Cancer as a prospective sequela of long COVID-19Geetanjali Saini 1, Ritu Aneja 1

Doorless Carp, I knew about your alluded to study being retracted. Was this one, too?

Thank you!!

Expand full comment
DoorlessCarp🐭's avatar

Thanks, I've saved that to my library.

It's good they refer to the tumor suppressors P53 & BRCA, but naturally without linking it to transfection & synthetic analogues.

Expand full comment
Potatodots's avatar

I think people who have been injected can be helped, generally, by aggressively denying terrain to the ever-replicating spike. A least buy more quality time (here I'm not saying don't get cancers, etc.). My theory after watching and listening to the doctors, reading a LOT of research papers, how even "natural infection" spike persists also, the WHC "spike detox" has a lot of choices, and I have gone through the literature on all of them, and potential interactions with each other and Rx. I believe reading up, carefully picking several, or enough (and taking IVM and or HCQ, quercetin, zinc, C, D3 is the essential foundation start), will deny terrain, boost what immune system is working.: https://worldcouncilforhealth.org/resources/spike-protein-detox-guide/

I read anecdotal evidence taking enough nattokinase digests those horrendous clots(!). Literature supports this.

I have watched where docs treated paralyzed nurses with IVM/HCQ plus, and they were able to return to work. These supplements, Rx can at least reduce symptoms for injured people., help clear brain fog.

Expand full comment
DoorlessCarp🐭's avatar

Quercetin, resveratrol, baicalin, berberine, artemisia, Gynostemma pentaphyllum and the nattokinase, serrapeptase series.

+Bromelain & icariin, hemp.

We have options here to clear amyloidogenic misfolded proteins & repair fractionated mitochondria.

Expand full comment
Potatodots's avatar

Yes. Amazing.

Excellent options.

I've been reading and saving papers. The liquid herbal extracts are far more targeted and far safer than the Harma chemistry analogs, as I know you are more aware than I.

Icariin is new to me; fascinating.

Looking forward to you coming posts. Your work is always engrossing. I have to divide up my reading sometimes, because it's dense (and rightly so) and then reread. I've printed them out for reference.

Expand full comment
DoorlessCarp🐭's avatar

Thank you. I may try to cut down some of the detail from each paper. I hilight key text in bold, why not just quote that with a brief synopsis for context in the intro?

Excluding content is challenging as it's all fascinating!

Expand full comment
Charles Wright's avatar

Thanks again DC.

Expand full comment
mejbcart's avatar

the last image is just magnificent.

In regard to cancer, there are SO many theories behind, it is hard to untangle all the science.... One example, Dr. Hulda Clark, the origin of cancer=parasites... If you look at what ivermectin does, it looks like that part fits quite well.. If you look at Dr. Beard research you will find digestive enzymes as a weapon. If you look at food, in particular the GMO's, it is also part of it. And look at all the drugs, millions of them, and each inhibiting one, two or more normal physiological processes, thus clearly disturbing something.. And lastly, if you look at vaccines, the field exploads, in particular with covid genetically modifying injections.... Btw. the reverse transcriptase discovered with the dawn of viruses, was also one pretext to 'explain cancer' within 'viral origin of cancer'. It is a mess, multidimensional issue..

Expand full comment
Sally Gould's avatar

Just wow! I absolutely revere the late Dr. Clark. Quite honestly, I credit her with saving my life!! I am a member of the Hulda Clark Enthusiasts Group, and I am passionate about all of the gifts that she bestowed upon us. Indeed, in lieu of Ivermectin, her cloves, wormwood, and black walnut hull anti-parasite protocol is a basic tenet. ... Plus, any kind of oxidative therapies are critical for us. That is why ozone therapy and frequency medicine are imperative in these perilous times. ... Alas, we are bereft of her kind wisdom. and all of her Syncrometer-derived discoveries. ... Where ever she is now, I always wonder what she might be thinking, how her Syncrometer could test the jab vials and definitively let us know what is in them. Alas...

Endless thanks to mejbcart , Pandelis, and Doorless Carp!!

Expand full comment
mejbcart's avatar

Yes, Dr. Clark was incredible with her knowledge. Thanks God, her family member continues the business of selling her remedies. Just recently found a great video of her explaining the circuitry of the synchrometer.. Oh just found it:

https://www.brighteon.com/258ae76e-bf08-4f09-b4f9-85423ea1e717

Syncrometer Basics: How to Use and Make the Syncrometer

Expand full comment
Sally Gould's avatar

No, Oskar, who runs the Dr. Clark Store, is not a family member. Unfortunately, no one from the Dr. Clark Store is a family member. I have been ordering from the Dr. Clark Store since its inception.

Thank you for the Syncrometer video. Dr. Clark hugely wished that the Syncrometer could be automated, but no one could successfully do it. That would be beyond wonderful!

Expand full comment
DoorlessCarp🐭's avatar

It certainly is!

Matt posted earlier about a treatment for long Covid using Truvada, an AIDS treatment that appears to be 2x reverse transcriptase inhibitors.

Expand full comment
mejbcart's avatar

hopefully not the AZT, the Fauci's favorite one...

Expand full comment
DoorlessCarp🐭's avatar

Tenofovir triphosphate inhibits the activity of HIV-1 reverse transcriptase by competing with the natural substrate deoxyadenosine 5′-triphosphate and, after incorporation into DNA, by DNA chain termination.

From: Encyclopedia of Microbiology (Third Edition), 2009

Tenofovir-based PrEP for COVID-19: an untapped opportunity?

https://www.ncbi.nlm.nih.gov/pmc/articles/PMC8243808/

Expand full comment
DoorlessCarp🐭's avatar

TRUVADA is a combination of emtricitabine and tenofovir disoproxil fumarate.

https://www.truvada.com/

...Emtricitabine, with trade name Emtriva, is a nucleoside reverse-transcriptase inhibitor for the prevention and treatment of HIV infection in adults and children.

...Tenofovir DF (brand name: Viread) is a prescription medicine approved by the U.S. Food and Drug Administration (FDA) for the treatment of HIV infection in adults and children 2 years of age and older who weigh at least 22 lb (10 kg). Tenofovir DF is always used in combination with other HIV medicines.

Expand full comment
mejbcart's avatar

That's quite a load, of 'side'-effects, if you look at it more closely at https://www.drugs.com/mtm/emtricitabine-and-tenofovir.html:...

"Before taking this medicine

You should not take emtricitabine and tenofovir if you are allergic to emtricitabine or tenofovir. Do not take if you also use other medicines that contain emtricitabine, tenofovir, lamivudine, or adefovir (such as Atripla, Combivir, Complera, Descovy, Dutrebis, Emtriva, Epivir, Epzicom, Genvoya, Hepsera, Odefsey, Stribild, Triumeq, Trizivir, or Viread)."

Just reading some of the VAERS reports indicates, that MANY of the deceased after the covid injections, were already on a load of drugs....

If you look at:

https://mejbcart.substack.com/p/how-much-hiv-is-in-sars-cov-2-faucis

one could almost imagine, these cocktails should work pretty similar in case of covid19, i.e kill similarly...

Expand full comment
DoorlessCarp🐭's avatar

I'm certainly not recommending them, it's curious they are both RT inhibitors and repurposed HIV drugs 🤔.

I'm more into flavonoids & polyphenols!

Expand full comment
mejbcart's avatar

me too, prefer everything what comes out from the earth rather then from a biochemical labs, Rockefellers 'paradises'...

Expand full comment